PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016438865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 127aa    MW: 14271.4 Da    PI: 10.4812
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016438865.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.71.5e-231459449
                    -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +n+sn qvtfskRr+g++KKA+EL++LC+ae+a+++fs+  k+y +
  XP_016438865.1 14 QNESNLQVTFSKRRAGLFKKASELCTLCGAEIALVVFSPGKKVYSF 59
                    79******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-31362IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.633363IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-27476IPR002100Transcription factor, MADS-box
CDDcd002659.99E-34473No hitNo description
PRINTSPR004043.6E-19525IPR002100Transcription factor, MADS-box
PfamPF003191.7E-251259IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-192540IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-194061IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MAKGRQKVDM VKMQNESNLQ VTFSKRRAGL FKKASELCTL CGAEIALVVF SPGKKVYSFG  60
HPCVDSVMDR FLTRNSQPNN GHNQLIVAHR NASVRDLNME LTNIEGILQM EKNRGEALQA  120
RKRDNGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A8e-16491188Myocyte-specific enhancer factor 2A
3kov_B8e-16491188Myocyte-specific enhancer factor 2A
3kov_I8e-16491188Myocyte-specific enhancer factor 2A
3kov_J8e-16491188Myocyte-specific enhancer factor 2A
3p57_A8e-16491188Myocyte-specific enhancer factor 2A
3p57_B8e-16491188Myocyte-specific enhancer factor 2A
3p57_C8e-16491188Myocyte-specific enhancer factor 2A
3p57_D8e-16491188Myocyte-specific enhancer factor 2A
3p57_I8e-16491188Myocyte-specific enhancer factor 2A
3p57_J8e-16491188Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016438865.11e-91PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK23e-49AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7T3N47e-59D7T3N4_VITVI; Putative uncharacterized protein
TrEMBLK4B2P01e-58K4B2P0_SOLLC; Uncharacterized protein
STRINGVIT_03s0088g00550.t012e-58(Vitis vinifera)
STRINGSolyc01g106730.1.13e-58(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20424223
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-50AGAMOUS-like 62